PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009626377.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 322aa    MW: 35676.9 Da    PI: 8.3055
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009626377.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.94.1e-33158216159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDg++WrKYGqK vk+s+fprsYYrCt+a+C vkk+vers+ed+++v++tYeg H+h+
  XP_009626377.1 158 LDDGFRWRKYGQKAVKNSPFPRSYYRCTTATCGVKKRVERSSEDTSIVVTTYEGIHTHP 216
                     59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.1E-33143218IPR003657WRKY domain
SuperFamilySSF1182906.28E-29150218IPR003657WRKY domain
PROSITE profilePS5081130.71153218IPR003657WRKY domain
SMARTSM007744.2E-39158217IPR003657WRKY domain
PfamPF031064.3E-26159216IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MADKENKLKP DTSSLEISTF SDQIPASTYS LFDMPTCETE KGSSLSLMFS SHPITTPSIF  60
DLLQPPPPPP VPLLVPSQLK IVNKIPSSEI VNTPNSSSIS SSSTEAAAND DQLQATTKTV  120
DDDDEHKNKK QLKPKKKNQK RQREPRFAFM TKSEVDHLDD GFRWRKYGQK AVKNSPFPRS  180
YYRCTTATCG VKKRVERSSE DTSIVVTTYE GIHTHPCPIT PRTSIGILPE ATAYGGSIGG  240
GGGSSSLFIP QFHYQASQQQ QQTYFQTPTL PINFISTSDS SLYSSQERRF SPSTSSSSSL  300
ARDHGLLQDM VPSQMRRDPK EE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-251512181077Probable WRKY transcription factor 4
2lex_A3e-251512181077Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009626377.10.0PREDICTED: probable WRKY transcription factor 48
SwissprotO229002e-56WRK23_ARATH; Probable WRKY transcription factor 23
TrEMBLM1ATF41e-104M1ATF4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000298121e-104(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13092479
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49520.14e-48WRKY DNA-binding protein 48